TPST2 (NM_001008566) Human Recombinant Protein

CAT#: TP304969

Recombinant protein of human tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 1

Product Images

Coomassie blue staining of purified TPST2 protein (Cat# TP304969). The protein was produced from HEK293T cells transfected with TPST2 cDNA clone (Cat# RC204969) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204969 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPL
  IFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF
  ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDC
  LTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLS
  KIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLK
  GDYKTPANLKGYFQVNQNSTSSHLGSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001008566
• Locus ID: 8459
• UniProt ID: O60704, A0A024R1G9
• Cytogenetics: 22q12.1
• Refseq Size: 2018
• Refseq ORF: 1131
• Synonyms: TANGO13B; TPST-2
• Summary: The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018]
• Protein Families: Transmembrane