ABHD2 (NM_007011) Human Mass Spec Standard
CAT#: PH305260
ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_008942)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205260 |
Predicted MW | 48.3 kDa |
Protein Sequence |
>RC205260 protein sequence
Red=Cloning site Green=Tags(s) MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPL IWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEK QYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGG NIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCQRFYNFLMADNMKKIILSHRQALFGDHV KKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE SLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQV EADLE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_008942 |
RefSeq Size | 9159 |
RefSeq ORF | 1275 |
Synonyms | HS1-2; LABH2; PHPS1-2 |
Locus ID | 11057 |
UniProt ID | P08910, A0A024RC89 |
Cytogenetics | 15q26.1 |
Summary | This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402075 | ABHD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407219 | ABHD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402075 | Transient overexpression lysate of abhydrolase domain containing 2 (ABHD2), transcript variant 1 |
USD 396.00 |
|
LY407219 | Transient overexpression lysate of abhydrolase domain containing 2 (ABHD2), transcript variant 2 |
USD 396.00 |
|
PH310637 | ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_690888) |
USD 2,055.00 |
|
TP305260 | Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 1 |
USD 823.00 |
|
TP310637 | Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review