ABHD2 (NM_007011) Human Recombinant Protein

CAT#: TP305260

Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 1

Product Images

Coomassie blue staining of purified ABHD2 protein (Cat# TP305260). The protein was produced from HEK293T cells transfected with ABHD2 cDNA clone (Cat# RC205260) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205260 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPL
  IWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEK
  QYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGG
  NIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCQRFYNFLMADNMKKIILSHRQALFGDHV
  KKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE
  SLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQV
  EADLE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 48.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008942
• Locus ID: 11057
• UniProt ID: P08910, A0A024RC89
• Cytogenetics: 15q26.1
• Refseq Size: 9159
• Refseq ORF: 1275
• Synonyms: HS1-2; LABH2; PHPS1-2
• Summary: This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jan 2017]