GNG4 (NM_004485) Human Mass Spec Standard

CAT#: PH305299

GNG4 MS Standard C13 and N15-labeled recombinant protein (NP_004476)

Product Images

Coomassie blue staining of purified GNG4 protein (Cat# TP305299). The protein was produced from HEK293T cells transfected with GNG4 cDNA clone (Cat# RC205299) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205299
• Predicted MW: 8.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205299 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF
  FCTIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004476
• RefSeq Size: 4885
• RefSeq ORF: 225
• Synonyms: DKFZp547K1018; FLJ23803; FLJ34187
• Locus ID: 2786
• UniProt ID: P50150, B1APZ0
• Cytogenetics: 1q42.3
• Summary: ''
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway