GNG4 (NM_004485) Human Recombinant Protein
CAT#: TP305299
Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205299 protein sequence
Red=Cloning site Green=Tags(s) MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF FCTIL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004476 |
Locus ID | 2786 |
UniProt ID | P50150, B1APZ0 |
Cytogenetics | 1q42.3 |
Refseq Size | 4885 |
Refseq ORF | 225 |
Summary | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417963 | GNG4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420667 | GNG4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420668 | GNG4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417963 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 3 |
USD 396.00 |
|
LY420667 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 2 |
USD 396.00 |
|
LY420668 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 1 |
USD 396.00 |
|
PH305299 | GNG4 MS Standard C13 and N15-labeled recombinant protein (NP_004476) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review