CD83 (NM_004233) Human Mass Spec Standard
CAT#: PH305302
CD83 MS Standard C13 and N15-labeled recombinant protein (NP_004224)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205302 |
| Predicted MW | 23 kDa |
| Protein Sequence |
>RC205302 protein sequence
Red=Cloning site Green=Tags(s) MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRG QHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKK YRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004224 |
| RefSeq Size | 2478 |
| RefSeq ORF | 615 |
| Synonyms | BL11; HB15 |
| Locus ID | 9308 |
| UniProt ID | Q01151 |
| Cytogenetics | 6p23 |
| Summary | The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401360 | CD83 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421736 | CD83 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401360 | Transient overexpression lysate of CD83 molecule (CD83), transcript variant 1 |
USD 436.00 |
|
| LY421736 | Transient overexpression lysate of CD83 molecule (CD83), transcript variant 2 |
USD 436.00 |
|
| PH312520 | CD83 MS Standard C13 and N15-labeled recombinant protein (NP_001035370) |
USD 2,055.00 |
|
| TP305302 | Recombinant protein of human CD83 molecule (CD83), transcript variant 1 |
USD 439.00 |
|
| TP312520 | Recombinant protein of human CD83 molecule (CD83), transcript variant 2 |
USD 748.00 |
|
| TP720345 | Recombinant protein of human CD83 molecule (CD83), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China