CD83 (NM_004233) Human Recombinant Protein
CAT#: TP305302
Recombinant protein of human CD83 molecule (CD83), transcript variant 1
View other "CD83" proteins (8)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205302 protein sequence
Red=Cloning site Green=Tags(s) MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRG QHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKK YRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004224 |
Locus ID | 9308 |
UniProt ID | Q01151 |
Cytogenetics | 6p23 |
Refseq Size | 2478 |
Refseq ORF | 615 |
Synonyms | BL11; HB15 |
Summary | The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401360 | CD83 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421736 | CD83 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401360 | Transient overexpression lysate of CD83 molecule (CD83), transcript variant 1 |
USD 396.00 |
|
LY421736 | Transient overexpression lysate of CD83 molecule (CD83), transcript variant 2 |
USD 396.00 |
|
PH305302 | CD83 MS Standard C13 and N15-labeled recombinant protein (NP_004224) |
USD 2,055.00 |
|
PH312520 | CD83 MS Standard C13 and N15-labeled recombinant protein (NP_001035370) |
USD 2,055.00 |
|
TP312520 | Recombinant protein of human CD83 molecule (CD83), transcript variant 2 |
USD 748.00 |
|
TP720345 | Recombinant protein of human CD83 molecule (CD83), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review