CD83 (NM_001040280) Human Mass Spec Standard

CAT#: PH312520

CD83 MS Standard C13 and N15-labeled recombinant protein (NP_001035370)

Product Images

Coomassie blue staining of purified CD83 protein (Cat# TP312520). The protein was produced from HEK293T cells transfected with CD83 cDNA clone (Cat# RC212520) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212520
• Predicted MW: 23 kDa
• Protein Sequence:
  Sequence Link

  >RC212520 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRG
  QHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKK
  YRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035370
• RefSeq Size: 2475
• RefSeq ORF: 615
• Synonyms: BL11; HB15
• Locus ID: 9308
• UniProt ID: Q01151
• Cytogenetics: 6p23
• Summary: The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Protein Families: Transmembrane