PEA15 (NM_003768) Human Mass Spec Standard

CAT#: PH305507

PEA15 MS Standard C13 and N15-labeled recombinant protein (NP_003759)

Product Images

Coomassie blue staining of purified PEA15 protein (Cat# TP305507). The protein was produced from HEK293T cells transfected with PEA15 cDNA clone (Cat# RC205507) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205507
• Predicted MW: 15 kDa
• Protein Sequence:
  Sequence Link

  >RC205507 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS
  RRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003759
• RefSeq Size: 2509
• RefSeq ORF: 390
• Synonyms: HMAT1; HUMMAT1H; MAT1; MAT1H; PEA-15; PED; PED-PEA15; PED/PEA15
• Locus ID: 8682
• UniProt ID: Q15121, B1AKZ4, Q96FS5
• Cytogenetics: 1q23.2
• Summary: This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Families: Druggable Genome