SERPINB4 (NM_002974) Human Mass Spec Standard

CAT#: PH305612

SERPINB4 MS Standard C13 and N15-labeled recombinant protein (NP_002965)

Product Images

Coomassie blue staining of purified SERPINB4 protein (Cat# TP305612). The protein was produced from HEK293T cells transfected with SERPINB4 cDNA clone (Cat# RC205612) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205612
• Predicted MW: 44.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205612 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKA
  ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFANAP
  EESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV
  QMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCV
  DLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVV
  VVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002965
• RefSeq Size: 1787
• RefSeq ORF: 1170
• Synonyms: LEUPIN; PI11; SCCA-2; SCCA1; SCCA2
• Locus ID: 6318
• UniProt ID: P48594
• Cytogenetics: 18q21.33
• Summary: 'The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B3, can be processed into smaller fragments that aggregate to form an autoantigen in psoriasis, probably by causing chronic inflammation. [provided by RefSeq, Jan 2017]'
• Protein Families: Druggable Genome, Secreted Protein