SERPINB4 (NM_002974) Human Recombinant Protein
CAT#: TP305612
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4)
View other "SERPINB4" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205612 protein sequence
Red=Cloning site Green=Tags(s) MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKA ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFANAP EESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV QMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCV DLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVV VVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002965 |
Locus ID | 6318 |
UniProt ID | P48594 |
Cytogenetics | 18q21.33 |
Refseq Size | 1787 |
Refseq ORF | 1170 |
Synonyms | LEUPIN; PI11; SCCA-2; SCCA1; SCCA2 |
Summary | The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B3, can be processed into smaller fragments that aggregate to form an autoantigen in psoriasis, probably by causing chronic inflammation. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418979 | SERPINB4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418979 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4) |
USD 396.00 |
|
PH305612 | SERPINB4 MS Standard C13 and N15-labeled recombinant protein (NP_002965) |
USD 2,055.00 |
|
TP790064 | Purified recombinant protein of Human serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4), with N-terminal HIS tag, expressed in HEK293, 50ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review