SERPINB4 (NM_002974) Human Recombinant Protein

CAT#: TP305612

Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4)

Product Images

Coomassie blue staining of purified SERPINB4 protein (Cat# TP305612). The protein was produced from HEK293T cells transfected with SERPINB4 cDNA clone (Cat# RC205612) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205612 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKA
  ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFANAP
  EESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV
  QMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCV
  DLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVV
  VVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002965
• Locus ID: 6318
• UniProt ID: P48594
• Cytogenetics: 18q21.33
• Refseq Size: 1787
• Refseq ORF: 1170
• Synonyms: LEUPIN; PI11; SCCA-2; SCCA1; SCCA2
• Summary: The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B3, can be processed into smaller fragments that aggregate to form an autoantigen in psoriasis, probably by causing chronic inflammation. [provided by RefSeq, Jan 2017]
• Protein Families: Druggable Genome, Secreted Protein