C10orf32 (BORCS7) (NM_144591) Human Mass Spec Standard

CAT#: PH305618

C10orf32 MS Standard C13 and N15-labeled recombinant protein (NP_653192)

Product Images

Coomassie blue staining of purified BORCS7 protein (Cat# TP305618). The protein was produced from HEK293T cells transfected with BORCS7 cDNA clone (Cat# RC205618) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205618
• Predicted MW: 11.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205618 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLR
  KMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_653192
• RefSeq Size: 1653
• RefSeq ORF: 315
• Synonyms: C10orf32
• Locus ID: 119032
• UniProt ID: Q96B45, A0A0B4J1R7
• Cytogenetics: 10q24.32