C10orf32 (BORCS7) (NM_144591) Human Recombinant Protein

CAT#: TP305618

Recombinant protein of human chromosome 10 open reading frame 32 (C10orf32), transcript variant 2

Product Images

Coomassie blue staining of purified BORCS7 protein (Cat# TP305618). The protein was produced from HEK293T cells transfected with BORCS7 cDNA clone (Cat# RC205618) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205618 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLR
  KMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_653192
• Locus ID: 119032
• UniProt ID: Q96B45, A0A0B4J1R7
• Cytogenetics: 10q24.32
• Refseq Size: 1653
• Refseq ORF: 315
• Synonyms: C10orf32
• Summary: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor.[UniProtKB/Swiss-Prot Function]