C10orf32 (BORCS7) (NM_144591) Human Recombinant Protein
CAT#: TP305618
Recombinant protein of human chromosome 10 open reading frame 32 (C10orf32), transcript variant 2
View other "BORCS7" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205618 protein sequence
Red=Cloning site Green=Tags(s) MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLR KMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653192 |
Locus ID | 119032 |
UniProt ID | Q96B45, A0A0B4J1R7 |
Cytogenetics | 10q24.32 |
Refseq Size | 1653 |
Refseq ORF | 315 |
Synonyms | C10orf32 |
Summary | As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408265 | C10orf32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408265 | Transient overexpression lysate of chromosome 10 open reading frame 32 (C10orf32), transcript variant 2 |
USD 396.00 |
|
PH305618 | C10orf32 MS Standard C13 and N15-labeled recombinant protein (NP_653192) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review