UBE2D1 (NM_003338) Human Mass Spec Standard

CAT#: PH305621

UBE2D1 MS Standard C13 and N15-labeled recombinant protein (NP_003329)

Product Images

Coomassie blue staining of purified UBE2D1 protein (Cat# TP305621). The protein was produced from HEK293T cells transfected with UBE2D1 cDNA clone (Cat# RC205621) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205621
• Predicted MW: 16.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205621 representing NM_003338
  Red=Cloning site Green=Tags(s)
  
  MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT
  TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE
  WTQKYAM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003329
• RefSeq Size: 2669
• RefSeq ORF: 441
• Synonyms: E2(17)KB1; SFT; UBC4/5; UBCH5; UBCH5A
• Locus ID: 7321
• UniProt ID: P51668, A0A024QZJ2
• Cytogenetics: 10q21.1
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]
• Protein Pathways: Ubiquitin mediated proteolysis