UBE2D1 (NM_003338) Human Recombinant Protein
CAT#: TP305621
Recombinant protein of human ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) (UBE2D1)
View other "UBE2D1" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205621 representing NM_003338
Red=Cloning site Green=Tags(s) MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE WTQKYAM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003329 |
Locus ID | 7321 |
UniProt ID | P51668, A0A024QZJ2 |
Cytogenetics | 10q21.1 |
Refseq Size | 2669 |
Refseq ORF | 441 |
Synonyms | E2(17)KB1; SFT; UBC4/5; UBCH5; UBCH5A |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418756 | UBE2D1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418756 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) (UBE2D1) |
USD 396.00 |
|
PH305621 | UBE2D1 MS Standard C13 and N15-labeled recombinant protein (NP_003329) |
USD 2,055.00 |
|
TP721188 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2D 1 (UBE2D1), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review