KCTD6 (NM_153331) Human Mass Spec Standard
CAT#: PH305633
KCTD6 MS Standard C13 and N15-labeled recombinant protein (NP_699162)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205633 |
Predicted MW | 27.6 kDa |
Protein Sequence |
>RC205633 protein sequence
Red=Cloning site Green=Tags(s) MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLN FLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVII TQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRV HHMSERANENTVEHNWTFCRLARKTDD SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_699162 |
RefSeq Size | 1840 |
RefSeq ORF | 711 |
Synonyms | KCASH3 |
Locus ID | 200845 |
UniProt ID | Q8NC69 |
Cytogenetics | 3p14.3 |
Protein Families | Ion Channels: Other |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407050 | KCTD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426928 | KCTD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407050 | Transient overexpression lysate of potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1 |
USD 396.00 |
|
LY426928 | Transient overexpression lysate of potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2 |
USD 396.00 |
|
PH325297 | KCTD6 MS Standard C13 and N15-labeled recombinant protein (NP_001121686) |
USD 2,055.00 |
|
TP305633 | Recombinant protein of human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1 |
USD 823.00 |
|
TP325297 | Recombinant protein of human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review