KCTD6 (NM_153331) Human Recombinant Protein
CAT#: TP305633
Recombinant protein of human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205633 protein sequence
Red=Cloning site Green=Tags(s) MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLN FLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVII TQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRV HHMSERANENTVEHNWTFCRLARKTDD SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 27.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_699162 |
Locus ID | 200845 |
UniProt ID | Q8NC69 |
Cytogenetics | 3p14.3 |
Refseq Size | 1840 |
Refseq ORF | 711 |
Synonyms | KCASH3 |
Summary | Probable substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex mediating the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the ubiquitination of HDAC1; the function seems to depend on KCTD11:KCTD6 oligomerization. Can function as antagonist of the Hedgehog pathway by affecting the nuclear transfer of transcription factor GLI1; the function probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. Inhibits cell growth and tumorigenicity of medulloblastoma (MDB) (PubMed:21472142). Involved in regulating protein levels of ANK1 isoform Mu17 probably implicating CUL3-dependent proteasomal degradation (PubMed:22573887).[UniProtKB/Swiss-Prot Function] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407050 | KCTD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426928 | KCTD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY407050 | Transient overexpression lysate of potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1 |
USD 325.00 |
|
LY426928 | Transient overexpression lysate of potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2 |
USD 325.00 |
|
PH305633 | KCTD6 MS Standard C13 and N15-labeled recombinant protein (NP_699162) |
USD 2,055.00 |
|
PH325297 | KCTD6 MS Standard C13 and N15-labeled recombinant protein (NP_001121686) |
USD 2,055.00 |
|
TP325297 | Recombinant protein of human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review