CBX1 (NM_006807) Human Mass Spec Standard

CAT#: PH305672

CBX1 MS Standard C13 and N15-labeled recombinant protein (NP_006798)

Product Images

Coomassie blue staining of purified CBX1 protein (Cat# TP305672). The protein was produced from HEK293T cells transfected with CBX1 cDNA clone (Cat# RC205672) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205672
• Predicted MW: 21.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205672 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQS
  QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKN
  SDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006798
• RefSeq Size: 2443
• RefSeq ORF: 555
• Synonyms: CBX; HP1-BETA; HP1Hs-beta; HP1Hsbeta; M31; MOD1; p25beta
• Locus ID: 10951
• UniProt ID: P83916, Q6IBN6
• Cytogenetics: 17q21.32
• Summary: This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]