CBX1 (NM_006807) Human Recombinant Protein

CAT#: TP305672

Recombinant protein of human chromobox homolog 1 (HP1 beta homolog Drosophila ) (CBX1), transcript variant 1

Product Images

Coomassie blue staining of purified CBX1 protein (Cat# TP305672). The protein was produced from HEK293T cells transfected with CBX1 cDNA clone (Cat# RC205672) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205672 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQS
  QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKN
  SDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006798
• Locus ID: 10951
• UniProt ID: P83916, Q6IBN6
• Cytogenetics: 17q21.32
• Refseq Size: 2443
• Refseq ORF: 555
• Synonyms: CBX; HP1-BETA; HP1Hs-beta; HP1Hsbeta; M31; MOD1; p25beta
• Summary: This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]