DEK (NM_003472) Human Mass Spec Standard

CAT#: PH305754

DEK MS Standard C13 and N15-labeled recombinant protein (NP_003463)

Product Images

Coomassie blue staining of purified DEK protein (Cat# TP305754). The protein was produced from HEK293T cells transfected with DEK cDNA clone (Cat# RC205754) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205754
• Predicted MW: 42.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205754 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSASAPAAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEGKREKKKVERLTMQV
  SSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTVSSLKKNVGQFSGFPFEKGSV
  QYKKKEEMLKKFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKTCSKGSKKERNS
  SGMARKAKRTKCPEILSDESSSDEDEKKNKEESSDDEDKESEEEPPKKTAKREKPKQKATSKSKKSVKSA
  NVKKADSSTTKKNQNSSKKESESEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKV
  YENYPTYDLTERKDFIKTTVKELIS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003463
• RefSeq Size: 2879
• RefSeq ORF: 1125
• Synonyms: D6S231E
• Locus ID: 7913
• UniProt ID: P35659
• Cytogenetics: 6p22.3
• Summary: This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene, and the presence of antibodies against this protein are all associated with various diseases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]
• Protein Families: Druggable Genome, Transcription Factors