DEK (NM_003472) Human Recombinant Protein
CAT#: TP305754
Recombinant protein of human DEK oncogene (DEK), transcript variant 1
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205754 protein sequence
Red=Cloning site Green=Tags(s) MSASAPAAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEGKREKKKVERLTMQV SSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTVSSLKKNVGQFSGFPFEKGSV QYKKKEEMLKKFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKTCSKGSKKERNS SGMARKAKRTKCPEILSDESSSDEDEKKNKEESSDDEDKESEEEPPKKTAKREKPKQKATSKSKKSVKSA NVKKADSSTTKKNQNSSKKESESEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKV YENYPTYDLTERKDFIKTTVKELIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003463 |
Locus ID | 7913 |
UniProt ID | P35659 |
Cytogenetics | 6p22.3 |
Refseq Size | 2879 |
Refseq ORF | 1125 |
Synonyms | D6S231E |
Summary | This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene, and the presence of antibodies against this protein are all associated with various diseases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418656 | DEK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418656 | Transient overexpression lysate of DEK oncogene (DEK), transcript variant 1 |
USD 396.00 |
|
PH305754 | DEK MS Standard C13 and N15-labeled recombinant protein (NP_003463) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review