KCTD11 (NM_001002914) Human Mass Spec Standard

CAT#: PH305782

KCTD11 MS Standard C13 and N15-labeled recombinant protein (NP_001002914)

Product Images

Coomassie blue staining of purified KCTD11 protein (Cat# TP305782). The protein was produced from HEK293T cells transfected with KCTD11 cDNA clone (Cat# RC205782) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205782
• Predicted MW: 25.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205782 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLL
  DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRAR
  FGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFR
  LDSVFPDPEDLLNSRSLRFVRH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001002914
• RefSeq Size: 3081
• RefSeq ORF: 696
• Synonyms: C17orf36; KCASH1; REN; REN/KCTD11
• Locus ID: 147040
• UniProt ID: Q693B1, A0A158RFT7
• Cytogenetics: 17p13.1
• Protein Families: Ion Channels: Other