KCTD11 (NM_001002914) Human Recombinant Protein
CAT#: TP305782
Recombinant protein of human potassium channel tetramerisation domain containing 11 (KCTD11)
View other "KCTD11" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205782 protein sequence
Red=Cloning site Green=Tags(s) MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLL DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRAR FGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFR LDSVFPDPEDLLNSRSLRFVRH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002914 |
Locus ID | 147040 |
UniProt ID | Q693B1, A0A158RFT7 |
Cytogenetics | 17p13.1 |
Refseq Size | 3081 |
Refseq ORF | 696 |
Synonyms | C17orf36; KCASH1; REN; REN/KCTD11 |
Summary | Plays a role as a marker and a regulator of neuronal differentiation; Up-regulated by a variety of neurogenic signals, such as retinoic acid, epidermal growth factor/EGF and NGFB/nerve growth factor. Induces apoptosis, growth arrest and the expression of cyclin-dependent kinase inhibitor CDKN1B. Plays a role as a tumor repressor and inhibits cell growth and tumorigenicity of medulloblastoma (MDB). Acts as probable substrate-specific adapter for a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex towards HDAC1. Functions as antagonist of the Hedgehog pathway on cell proliferation and differentiation by affecting the nuclear transfer of transcription factor GLI1, thus maintaining cerebellar granule cells in undifferentiated state, this effect probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. When knock-down, Hedgehog antagonism is impaired and proliferation of granule cells is sustained. Activates the caspase cascade.[UniProtKB/Swiss-Prot Function] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424110 | KCTD11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY424110 | Transient overexpression lysate of potassium channel tetramerisation domain containing 11 (KCTD11) |
USD 396.00 |
|
PH305782 | KCTD11 MS Standard C13 and N15-labeled recombinant protein (NP_001002914) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review