HMG1 (HMGB1) (NM_002128) Human Mass Spec Standard

CAT#: PH305918

HMGB1 MS Standard C13 and N15-labeled recombinant protein (NP_002119)

Product Images

Coomassie blue staining of purified HMGB1 protein (Cat# TP305918). The protein was produced from HEK293T cells transfected with HMGB1 cDNA clone (Cat# RC205918) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205918
• Predicted MW: 24.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205918 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR
  YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD
  KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE
  DDDDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002119
• RefSeq Size: 3428
• RefSeq ORF: 645
• Synonyms: HMG-1; HMG1; HMG3; SBP-1
• Locus ID: 3146
• UniProt ID: P09429, A0A024RDR0
• Cytogenetics: 13q12.3
• Summary: 'This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Base excision repair