HMG1 (HMGB1) (NM_002128) Human Recombinant Protein
CAT#: TP305918
Recombinant protein of human high-mobility group box 1 (HMGB1)
View other "HMGB1" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205918 protein sequence
Red=Cloning site Green=Tags(s) MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE DDDDE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002119 |
Locus ID | 3146 |
UniProt ID | P09429, A0A024RDR0, Q5T7C3 |
Cytogenetics | 13q12.3 |
Refseq Size | 3428 |
Refseq ORF | 645 |
Synonyms | HMG-1; HMG1; HMG3; SBP-1 |
Summary | This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Base excision repair |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400775 | HMGB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400775 | Transient overexpression lysate of high-mobility group box 1 (HMGB1) |
USD 396.00 |
|
PH305918 | HMGB1 MS Standard C13 and N15-labeled recombinant protein (NP_002119) |
USD 2,055.00 |
|
TP720309 | Recombinant protein of human high-mobility group box 1 (HMGB1) |
USD 330.00 |
|
TP721133 | Purified recombinant protein of Human high mobility group box 1 (HMGB1) |
USD 330.00 |
|
TP721198 | Purified recombinant protein of Human high mobility group box 1 (HMGB1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review