MTP18 (MTFP1) (NM_016498) Human Mass Spec Standard

CAT#: PH305922

MTP18 MS Standard C13 and N15-labeled recombinant protein (NP_057582)

Product Images

Coomassie blue staining of purified MTFP1 protein (Cat# TP305922). The protein was produced from HEK293T cells transfected with MTFP1 cDNA clone (Cat# RC205922) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205922
• Predicted MW: 18 kDa
• Protein Sequence:
  Sequence Link

  >RC205922 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPE
  AGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHP
  IDRSVDFLLDSSLRKLYPTVGKPSSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057582
• RefSeq Size: 1298
• RefSeq ORF: 498
• Synonyms: HSPC242; MTP18
• Locus ID: 51537
• UniProt ID: Q9UDX5, A0A024R1E4
• Cytogenetics: 22q12.2
• Summary: MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]). [supplied by OMIM, Mar 2008]