MTP18 (MTFP1) (NM_016498) Human Recombinant Protein

CAT#: TP305922

Purified recombinant protein of Homo sapiens mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 1

Product Images

Coomassie blue staining of purified MTFP1 protein (Cat# TP305922). The protein was produced from HEK293T cells transfected with MTFP1 cDNA clone (Cat# RC205922) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205922 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPE
  AGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHP
  IDRSVDFLLDSSLRKLYPTVGKPSSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057582
• Locus ID: 51537
• UniProt ID: Q9UDX5, A0A024R1E4
• Cytogenetics: 22q12.2
• Refseq Size: 1298
• Refseq ORF: 498
• Synonyms: HSPC242; MTP18
• Summary: MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM, Mar 2008]