ATG4C (NM_178221) Human Mass Spec Standard

CAT#: PH305955

ATG4C MS Standard C13 and N15-labeled recombinant protein (NP_835739)

Product Images

Coomassie blue staining of purified ATG4C protein (Cat# TP305955). The protein was produced from HEK293T cells transfected with ATG4C cDNA clone (Cat# RC205955) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205955
• Predicted MW: 52.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205955 representing NM_178221
  Red=Cloning site Green=Tags(s)
  
  MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDH
  VIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALN
  IENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLA
  LFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMT
  SDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQ
  SFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVN
  GHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_835739
• RefSeq Size: 1774
• RefSeq ORF: 1374
• Synonyms: APG4-C; APG4C; AUTL1; AUTL3
• Locus ID: 84938
• UniProt ID: Q96DT6, A0A384MTY5
• Cytogenetics: 1p31.3
• Summary: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008]
• Protein Families: Protease
• Protein Pathways: Regulation of autophagy