C11orf75 (SMCO4) (NM_020179) Human Mass Spec Standard

CAT#: PH306466

C11orf75 MS Standard C13 and N15-labeled recombinant protein (NP_064564)

Product Images

Coomassie blue staining of purified SMCO4 protein (Cat# TP306466). The protein was produced from HEK293T cells transfected with SMCO4 cDNA clone (Cat# RC206466) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206466
• Predicted MW: 6.7 kDa
• Protein Sequence:
  Sequence Link

  >RC206466 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064564
• RefSeq Size: 979
• RefSeq ORF: 177
• Synonyms: C11orf75; FN5
• Locus ID: 56935
• UniProt ID: Q9NRQ5, A0A024R3A3
• Cytogenetics: 11q21
• Protein Families: Transmembrane