C11orf75 (SMCO4) (NM_020179) Human Recombinant Protein

CAT#: TP306466

Recombinant protein of human chromosome 11 open reading frame 75 (C11orf75)

Product Images

Coomassie blue staining of purified SMCO4 protein (Cat# TP306466). The protein was produced from HEK293T cells transfected with SMCO4 cDNA clone (Cat# RC206466) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206466 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 6.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064564
• Locus ID: 56935
• UniProt ID: Q9NRQ5, A0A024R3A3
• Cytogenetics: 11q21
• Refseq Size: 979
• Refseq ORF: 177
• Synonyms: C11orf75; FN5
• Protein Families: Transmembrane