FKBP11 (NM_016594) Human Mass Spec Standard

CAT#: PH306481

FKBP11 MS Standard C13 and N15-labeled recombinant protein (NP_057678)

Product Images

Coomassie blue staining of purified FKBP11 protein (Cat# TP306481). The protein was produced from HEK293T cells transfected with FKBP11 cDNA clone (Cat# RC206481) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206481
• Predicted MW: 22.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206481 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVD
  GRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVEL
  IALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057678
• RefSeq Size: 767
• RefSeq ORF: 603
• Synonyms: FKBP19
• Locus ID: 51303
• UniProt ID: Q9NYL4
• Cytogenetics: 12q13.12
• Summary: FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Transmembrane