FKBP11 (NM_016594) Human Recombinant Protein

CAT#: TP306481

Recombinant protein of human FK506 binding protein 11, 19 kDa (FKBP11), transcript variant 1

Product Images

Coomassie blue staining of purified FKBP11 protein (Cat# TP306481). The protein was produced from HEK293T cells transfected with FKBP11 cDNA clone (Cat# RC206481) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206481 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVD
  GRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVEL
  IALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057678
• Locus ID: 51303
• UniProt ID: Q9NYL4
• Cytogenetics: 12q13.12
• Refseq Size: 767
• Refseq ORF: 603
• Synonyms: FKBP19
• Summary: FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]).[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Transmembrane