KCNE1L (KCNE5) (NM_012282) Human Mass Spec Standard

CAT#: PH306502

KCNE1L MS Standard C13 and N15-labeled recombinant protein (NP_036414)

Product Images

Coomassie blue staining of purified KCNE5 protein (Cat# TP306502). The protein was produced from HEK293T cells transfected with KCNE5 cDNA clone (Cat# RC206502) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206502
• Predicted MW: 15 kDa
• Protein Sequence:
  Sequence Link

  >RC206502 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFY
  ACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAE
  RV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036414
• RefSeq Size: 1465
• RefSeq ORF: 426
• Synonyms: KCNE1L
• Locus ID: 23630
• UniProt ID: Q9UJ90
• Cytogenetics: Xq23
• Summary: This gene encodes a member of a family of single pass transmembrane domain proteins that function as ancillary subunits to voltage-gated potassium channels. Members of this family affect diverse processes in potassium channel regulation, including ion selectivity, voltage dependence, and anterograde recycling from the plasma membrane. Variants of this gene are associated with idiopathic ventricular fibrillation and Brugada syndrome. [provided by RefSeq, Nov 2016]
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane