KCNE1L (KCNE5) (NM_012282) Human Recombinant Protein

CAT#: TP306502

Recombinant protein of human KCNE1-like (KCNE1L)

Product Images

Coomassie blue staining of purified KCNE5 protein (Cat# TP306502). The protein was produced from HEK293T cells transfected with KCNE5 cDNA clone (Cat# RC206502) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206502 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFY
  ACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAE
  RV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036414
• Locus ID: 23630
• UniProt ID: Q9UJ90
• Cytogenetics: Xq23
• Refseq Size: 1465
• Refseq ORF: 426
• Synonyms: KCNE1L
• Summary: This gene encodes a member of a family of single pass transmembrane domain proteins that function as ancillary subunits to voltage-gated potassium channels. Members of this family affect diverse processes in potassium channel regulation, including ion selectivity, voltage dependence, and anterograde recycling from the plasma membrane. Variants of this gene are associated with idiopathic ventricular fibrillation and Brugada syndrome. [provided by RefSeq, Nov 2016]
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane