Nkx2.5 (NKX2-5) (NM_004387) Human Mass Spec Standard

CAT#: PH306550

NKX2 MS Standard C13 and N15-labeled recombinant protein (NP_004378)

Product Images

Coomassie blue staining of purified NKX2-5 protein (Cat# TP306550). The protein was produced from HEK293T cells transfected with NKX2-5 cDNA clone (Cat# RC206550) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206550
• Predicted MW: 34.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206550 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELR
  AELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRK
  PRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPP
  PPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSP
  AQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004378
• RefSeq Size: 1669
• RefSeq ORF: 972
• Synonyms: CHNG5; CSX; CSX1; HLHS2; NKX2.5; NKX2E; NKX4-1; VSD3
• Locus ID: 1482
• UniProt ID: P52952, A0A0S2Z383
• Cytogenetics: 5q35.1
• Summary: 'This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]'
• Protein Families: Transcription Factors