Nkx2.5 (NKX2-5) (NM_004387) Human Recombinant Protein

CAT#: TP306550

Recombinant protein of human NK2 transcription factor related, locus 5 (Drosophila) (NKX2-5)

Product Images

Coomassie blue staining of purified NKX2-5 protein (Cat# TP306550). The protein was produced from HEK293T cells transfected with NKX2-5 cDNA clone (Cat# RC206550) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206550 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELR
  AELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRK
  PRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPP
  PPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSP
  AQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004378
• Locus ID: 1482
• UniProt ID: P52952, A0A0S2Z383
• Cytogenetics: 5q35.1
• Refseq Size: 1669
• Refseq ORF: 972
• Synonyms: CHNG5; CSX; CSX1; HLHS2; NKX2.5; NKX2E; NKX4-1; VSD3
• Summary: This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
• Protein Families: Transcription Factors