CD72 (NM_001782) Human Mass Spec Standard

CAT#: PH306609

CD72 MS Standard C13 and N15-labeled recombinant protein (NP_001773)

Product Images

Coomassie blue staining of purified CD72 protein (Cat# TP306609). The protein was produced from HEK293T cells transfected with CD72 cDNA clone (Cat# RC206609) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206609
• Predicted MW: 40.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206609 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQP
  TASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLR
  QQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALE
  QKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHS
  YYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYIC
  EMTAFRFPD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001773
• RefSeq Size: 1548
• RefSeq ORF: 1077
• Synonyms: CD72b; LYB2
• Locus ID: 971
• UniProt ID: P21854, Q5TLG3
• Cytogenetics: 9p13.3
• Summary: ''
• Protein Families: Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: B cell receptor signaling pathway