CD72 (NM_001782) Human Recombinant Protein
CAT#: TP720875
Purified recombinant protein of Human CD72 molecule (CD72)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQ
|
Tag | N-Trx-His |
Predicted MW | 30.6 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001773 |
Locus ID | 971 |
UniProt ID | P21854, Q5TLG3 |
Cytogenetics | 9p13.3 |
Refseq Size | 1548 |
Refseq ORF | 1077 |
Synonyms | CD72b; LYB2 |
Summary | '' |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | B cell receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400673 | CD72 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400673 | Transient overexpression lysate of CD72 molecule (CD72) |
USD 325.00 |
|
PH306609 | CD72 MS Standard C13 and N15-labeled recombinant protein (NP_001773) |
USD 2,055.00 |
|
TP306609 | Recombinant protein of human CD72 molecule (CD72) |
USD 823.00 |
|
TP700240 | Purified recombinant protein of human CD72 molecule (CD72), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review