CD72 (NM_001782) Human Recombinant Protein

CAT#: TP306609

Recombinant protein of human CD72 molecule (CD72)

Product Images

Coomassie blue staining of purified CD72 protein (Cat# TP306609). The protein was produced from HEK293T cells transfected with CD72 cDNA clone (Cat# RC206609) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206609 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQP
  TASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLR
  QQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALE
  QKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHS
  YYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYIC
  EMTAFRFPD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001773
• Locus ID: 971
• UniProt ID: P21854, Q5TLG3
• Cytogenetics: 9p13.3
• Refseq Size: 1548
• Refseq ORF: 1077
• Synonyms: CD72b; LYB2
• Summary: Plays a role in B-cell proliferation and differentiation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: B cell receptor signaling pathway