CD33 (NM_001772) Human Mass Spec Standard
CAT#: PH307023
CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001763)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207023 |
Predicted MW | 39.7 kDa |
Protein Sequence |
>RC207023 protein sequence
Red=Cloning site Green=Tags(s) MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGD SPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTD LTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNL TCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFF IVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP SKDTSTEYSEVRTQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001763 |
RefSeq Size | 1466 |
RefSeq ORF | 1092 |
Synonyms | p67; SIGLEC-3; SIGLEC3 |
Locus ID | 945 |
UniProt ID | P20138, Q546G0 |
Cytogenetics | 19q13.41 |
Summary | '' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Hematopoietic cell lineage |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400667 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421195 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425947 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432863 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400667 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 1 |
USD 325.00 |
|
LY421195 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 |
USD 325.00 |
|
LY425947 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 |
USD 325.00 |
|
LY432863 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 3 |
USD 325.00 |
|
PH317716 | CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001076087) |
USD 2,055.00 |
|
TP307023 | Recombinant protein of human CD33 molecule (CD33), transcript variant 1 |
USD 823.00 |
|
TP317716 | Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2 |
USD 823.00 |
|
TP720665 | Purified recombinant protein of Human CD33 molecule (CD33), transcript variant 1 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review