CD33 (NM_001772) Human Mass Spec Standard

CAT#: PH307023

CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001763)

Product Images

Coomassie blue staining of purified CD33 protein (Cat# TP307023). The protein was produced from HEK293T cells transfected with CD33 cDNA clone (Cat# RC207023) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207023
• Predicted MW: 39.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207023 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGD
  SPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTD
  LTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNL
  TCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFF
  IVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP
  SKDTSTEYSEVRTQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001763
• RefSeq Size: 1466
• RefSeq ORF: 1092
• Synonyms: p67; SIGLEC-3; SIGLEC3
• Locus ID: 945
• UniProt ID: P20138, Q546G0
• Cytogenetics: 19q13.41
• Summary: ''
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Hematopoietic cell lineage