CD33 (NM_001082618) Human Recombinant Protein
CAT#: TP317716
Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2
View other "CD33" proteins (12)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217716 representing NM_001082618
Red=Cloning site Green=Tags(s) MPLLLLLPLLWADLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVL IITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGV TALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEE LHYASLNFHGMNPSKDTSTEYSEVRTQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001076087 |
| Locus ID | 945 |
| UniProt ID | P20138 |
| Cytogenetics | 19q13.41 |
| Refseq Size | 1085 |
| Refseq ORF | 711 |
| Synonyms | p67; SIGLEC-3; SIGLEC3 |
| Summary | Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:15597323, PubMed:11320212). Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans (PubMed:7718872). Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK (PubMed:28325905, PubMed:10887109). These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10556798, PubMed:10206955, PubMed:10887109). In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules (PubMed:10206955, PubMed:10887109). One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K (PubMed:15597323).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400667 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421195 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425947 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC432863 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400667 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 1 |
USD 436.00 |
|
| LY421195 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 |
USD 436.00 |
|
| LY425947 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 |
USD 396.00 |
|
| LY432863 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 3 |
USD 436.00 |
|
| PH307023 | CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001763) |
USD 2,055.00 |
|
| PH317716 | CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001076087) |
USD 2,055.00 |
|
| TP307023 | Recombinant protein of human CD33 molecule (CD33), transcript variant 1 |
USD 823.00 |
|
| TP720665 | Purified recombinant protein of Human CD33 molecule (CD33), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China