UPP2 (NM_173355) Human Mass Spec Standard
CAT#: PH307260
UPP2 MS Standard C13 and N15-labeled recombinant protein (NP_775491)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207260 |
Predicted MW | 35.5 kDa |
Protein Sequence |
>RC207260 protein sequence
Red=Cloning site Green=Tags(s) MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNR MKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDV TIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLD RLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_775491 |
RefSeq Size | 2413 |
RefSeq ORF | 954 |
Synonyms | UDRPASE2; UP2; UPASE2 |
Locus ID | 151531 |
UniProt ID | O95045, A0A0S2Z634 |
Cytogenetics | 2q24.1 |
Summary | Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates. [UniProtKB/Swiss-Prot Function] |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406610 | UPP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406610 | Transient overexpression lysate of uridine phosphorylase 2 (UPP2), transcript variant 1 |
USD 325.00 |
|
TP307260 | Recombinant protein of human uridine phosphorylase 2 (UPP2), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review