UPP2 (NM_173355) Human Mass Spec Standard

CAT#: PH307260

UPP2 MS Standard C13 and N15-labeled recombinant protein (NP_775491)

Product Images

Coomassie blue staining of purified UPP2 protein (Cat# TP307260). The protein was produced from HEK293T cells transfected with UPP2 cDNA clone (Cat# RC207260) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207260
• Predicted MW: 35.5 kDa
• Protein Sequence:
  Sequence Link

  >RC207260 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNR
  MKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDV
  TIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV
  GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLD
  RLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_775491
• RefSeq Size: 2413
• RefSeq ORF: 954
• Synonyms: UDRPASE2; UP2; UPASE2
• Locus ID: 151531
• UniProt ID: O95045, A0A0S2Z634
• Cytogenetics: 2q24.1
• Summary: Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates. [UniProtKB/Swiss-Prot Function]
• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism