UPP2 (NM_173355) Human Recombinant Protein
CAT#: TP307260
Recombinant protein of human uridine phosphorylase 2 (UPP2), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207260 protein sequence
Red=Cloning site Green=Tags(s) MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNR MKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDV TIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLD RLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775491 |
Locus ID | 151531 |
UniProt ID | O95045, A0A0S2Z634 |
Cytogenetics | 2q24.1 |
Refseq Size | 2413 |
Refseq ORF | 954 |
Synonyms | UDRPASE2; UP2; UPASE2 |
Summary | Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406610 | UPP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406610 | Transient overexpression lysate of uridine phosphorylase 2 (UPP2), transcript variant 1 |
USD 396.00 |
|
PH307260 | UPP2 MS Standard C13 and N15-labeled recombinant protein (NP_775491) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review