HBLD1 (ISCA2) (NM_194279) Human Mass Spec Standard

CAT#: PH307304

ISCA2 MS Standard C13 and N15-labeled recombinant protein (NP_919255)

Product Images

Coomassie blue staining of purified ISCA2 protein (Cat# TP307304). The protein was produced from HEK293T cells transfected with ISCA2 cDNA clone (Cat# RC207304) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207304
• Predicted MW: 16.4 kDa
• Protein Sequence:
  Sequence Link

  >RC207304 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFL
  RLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQA
  QQGCSCGSSFSIKL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_919255
• RefSeq Size: 1088
• RefSeq ORF: 462
• Synonyms: c14_5557; HBLD1; ISA2; MMDS4
• Locus ID: 122961
• UniProt ID: Q86U28
• Cytogenetics: 14q24.3
• Summary: The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]