HBLD1 (ISCA2) (NM_194279) Human Recombinant Protein

CAT#: TP307304

Recombinant protein of human iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2)

Product Images

Coomassie blue staining of purified ISCA2 protein (Cat# TP307304). The protein was produced from HEK293T cells transfected with ISCA2 cDNA clone (Cat# RC207304) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207304 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFL
  RLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQA
  QQGCSCGSSFSIKL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_919255
• Locus ID: 122961
• UniProt ID: Q86U28
• Cytogenetics: 14q24.3
• Refseq Size: 1088
• Refseq ORF: 462
• Synonyms: c14_5557; HBLD1; ISA2; MMDS4
• Summary: The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]