JPT1 (NM_001002033) Human Mass Spec Standard
CAT#: PH307344
HN1 MS Standard C13 and N15-labeled recombinant protein (NP_001002033)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207344 |
Predicted MW | 11 kDa |
Protein Sequence |
>RC207344 protein sequence
Red=Cloning site Green=Tags(s) MASNIFGTPEENQASWAKSAGAKSSGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSL GQSEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001002033 |
RefSeq Size | 1705 |
RefSeq ORF | 324 |
Synonyms | ARM2; HN1; HN1A |
Locus ID | 51155 |
UniProt ID | Q9UK76 |
Cytogenetics | 17q25.1 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414136 | HN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424172 | HN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414136 | Transient overexpression lysate of hematological and neurological expressed 1 (HN1), transcript variant 1 |
USD 396.00 |
|
LY424172 | Transient overexpression lysate of hematological and neurological expressed 1 (HN1), transcript variant 3 |
USD 396.00 |
|
PH321865 | HN1 MS Standard C13 and N15-labeled recombinant protein (NP_057269) |
USD 2,055.00 |
|
TP307344 | Recombinant protein of human hematological and neurological expressed 1 (HN1), transcript variant 3 |
USD 823.00 |
|
TP321865 | Recombinant protein of human hematological and neurological expressed 1 (HN1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review