Germany
Japan
United Kingdom
China
JPT1 (NM_001002033) Human Mass Spec Standard
CAT#: PH307344
HN1 MS Standard C13 and N15-labeled recombinant protein (NP_001002033)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207344 |
| Predicted MW | 11 kDa |
| Protein Sequence |
>RC207344 protein sequence
Red=Cloning site Green=Tags(s) MASNIFGTPEENQASWAKSAGAKSSGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSL GQSEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001002033 |
| RefSeq Size | 1705 |
| RefSeq ORF | 324 |
| Synonyms | ARM2; HN1; HN1A |
| Locus ID | 51155 |
| UniProt ID | Q9UK76 |
| Cytogenetics | 17q25.1 |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414136 | HN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC424172 | HN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY414136 | Transient overexpression lysate of hematological and neurological expressed 1 (HN1), transcript variant 1 |
USD 396.00 |
|
| LY424172 | Transient overexpression lysate of hematological and neurological expressed 1 (HN1), transcript variant 3 |
USD 396.00 |
|
| PH321865 | HN1 MS Standard C13 and N15-labeled recombinant protein (NP_057269) |
USD 2,055.00 |
|
| TP307344 | Recombinant protein of human hematological and neurological expressed 1 (HN1), transcript variant 3 |
USD 823.00 |
|
| TP321865 | Recombinant protein of human hematological and neurological expressed 1 (HN1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review