JPT1 (NM_001002033) Human Recombinant Protein

CAT#: TP307344

Recombinant protein of human hematological and neurological expressed 1 (HN1), transcript variant 3

Product Images

Coomassie blue staining of purified JPT1 protein (Cat# TP307344). The protein was produced from HEK293T cells transfected with JPT1 cDNA clone (Cat# RC207344) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207344 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASNIFGTPEENQASWAKSAGAKSSGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSL
  GQSEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001002033
• Locus ID: 51155
• UniProt ID: Q9UK76
• Cytogenetics: 17q25.1
• Refseq Size: 1705
• Refseq ORF: 324
• Synonyms: ARM2; HN1; HN1A
• Summary: Modulates negatively AKT-mediated GSK3B signaling (PubMed:21323578, PubMed:22155408). Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the function of the APC:CTNNB1:GSK3B complex and the interaction with CDH1/E-cadherin in adherent junctions (PubMed:25169422). Plays a role in the regulation of cell cycle and cell adhesion (PubMed:25169422, PubMed:25450365). Has an inhibitory role on AR-signaling pathway through the induction of receptor proteosomal degradation (PubMed:22155408).[UniProtKB/Swiss-Prot Function]