JPT1 (NM_016185) Human Mass Spec Standard

CAT#: PH321865

HN1 MS Standard C13 and N15-labeled recombinant protein (NP_057269)

Product Images

Coomassie blue staining of purified JPT1 protein (Cat# TP321865). The protein was produced from HEK293T cells transfected with JPT1 cDNA clone (Cat# RC221865) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221865
• Predicted MW: 15.8 kDa
• Protein Sequence:
  Sequence Link

  >RC221865 representing NM_016185
  Red=Cloning site Green=Tags(s)
  
  MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKSAGAKS
  SGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPS
  RRNPPGGKSSLVLG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057269
• RefSeq Size: 1602
• RefSeq ORF: 462
• Synonyms: ARM2; HN1; HN1A
• Locus ID: 51155
• UniProt ID: Q9UK76
• Cytogenetics: 17q25.1