Centaurin alpha 1 (ADAP1) (NM_006869) Human Mass Spec Standard

CAT#: PH307549

ADAP1 MS Standard C13 and N15-labeled recombinant protein (NP_006860)

Product Images

Coomassie blue staining of purified ADAP1 protein (Cat# TP307549). The protein was produced from HEK293T cells transfected with ADAP1 cDNA clone (Cat# RC207549) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207549
• Predicted MW: 43.2 kDa
• Protein Sequence:
  Sequence Link

  >RC207549 representing NM_006869
  Red=Cloning site Green=Tags(s)
  
  MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQV
  EFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG
  RDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFI
  YHEDGKEIVDWFNALRAARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDR
  RLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAA
  FQKAVDRPMLPQEYAVEAHFKHKP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006860
• RefSeq Size: 2378
• RefSeq ORF: 1122
• Synonyms: CENTA1; GCS1L; p42IP4
• Locus ID: 11033
• UniProt ID: O75689
• Cytogenetics: 7p22.3
• Protein Families: Druggable Genome