Centaurin alpha 1 (ADAP1) (NM_006869) Human Recombinant Protein

CAT#: TP307549

Recombinant protein of human ArfGAP with dual PH domains 1 (ADAP1)

Product Images

Coomassie blue staining of purified ADAP1 protein (Cat# TP307549). The protein was produced from HEK293T cells transfected with ADAP1 cDNA clone (Cat# RC207549) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207549 representing NM_006869
  Red=Cloning site Green=Tags(s)
  
  MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQV
  EFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG
  RDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFI
  YHEDGKEIVDWFNALRAARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDR
  RLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAA
  FQKAVDRPMLPQEYAVEAHFKHKP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006860
• Locus ID: 11033
• UniProt ID: O75689
• Cytogenetics: 7p22.3
• Refseq Size: 2378
• Refseq ORF: 1122
• Synonyms: CENTA1; GCS1L; p42IP4
• Summary: GTPase-activating protein for the ADP ribosylation factor family (Probable). Binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome